SMART: Leuk-A4-hydro_C domain annotation

The domain within your query sequence starts at position 675 and ends at position 821; the E-value for the Leuk-A4-hydro_C domain shown below is 3.02e-37.

RLARQVGSEVAKWIRVNRRPRKRKRGKREVAFEKLSPDQIVLLLEWLLEQKTLSPQTLHC
LQQTYHLPEQDAEVRHRWCELVIKHKYTKAYNQVERFLLEDQAMGIYLYGELMVSEDARL
QQLAHRCFELVKEHMDRASAQVVTEML

Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal

SMART accession number:	SM01263
Description:	Members of this family adopt a structure consisting of two layers of parallel alpha-helices, five in the inner layer and four in the outer, arranged in an antiparallel manner, with perpendicular loops containing short helical segments on top. They are required for the formation of a deep cleft harbouring the catalytic Zn2+ site in Leukotriene A4 hydrolase (PUBMED:11175901).
Interpro abstract (IPR015211):	This C-terminal domain is found in peptidases belonging to MEROPS peptidase family M1, particularly: aminopeptidase-1 of Caenorhabditis elegans, aminopeptidase O, aminopeptidase B and the bifunctional leukotriene A4 (LTA-4) hydrolase/aminopeptidase. The domain adopts a structure consisting of two layers of parallel alpha-helices, five in the inner layer and four in the outer, arranged in an antiparallel manner, with perpendicular loops containing short helical segments on top. It is required for the formation of a deep cleft harbouring the catalytic Zn2+ site in leukotriene A4 hydrolase [ (PUBMED:11175901) ].
GO function:	zinc ion binding (GO:0008270), metallopeptidase activity (GO:0008237)
Family alignment:	View or

There are 3901 Leuk-A4-hydro_C domains in 3898 proteins in SMART's nrdb database.

Click on the following links for more information.

Evolution (species in which this domain is found)
Taxonomic distribution of proteins containing Leuk-A4-hydro_C domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with Leuk-A4-hydro_C domain is also avaliable.

Click on the protein counts, or double click on taxonomic names to display all proteins containing Leuk-A4-hydro_C domain in the selected taxonomic class.
Structure (3D structures containing this domain)

3D Structures of Leuk-A4-hydro_C domains in PDB

PDB code	Main view	Title
1gw6		STRUCTURE OF LEUKOTRIENE A4 HYDROLASE D375N MUTANT
1h19		STRUCTURE OF [E271Q]LEUKOTRIENE A4 HYDROLASE
1hs6		STRUCTURE OF LEUKOTRIENE A4 HYDROLASE COMPLEXED WITH BESTATIN.
1sqm		STRUCTURE OF [R563A] LEUKOTRIENE A4 HYDROLASE
2r59		Leukotriene A4 hydrolase complexed with inhibitor RB3041
2vj8		Complex of human leukotriene A4 hydrolase with a hydroxamic acid inhibitor
2xpy		Structure of Native Leukotriene A4 Hydrolase from Saccharomyces cerevisiae
2xpz		Structure of native yeast LTA4 hydrolase
2xq0		Structure of yeast LTA4 hydrolase in complex with Bestatin
3b7r		Leukotriene A4 Hydrolase Complexed with Inhibitor RB3040
3b7s		[E296Q]LTA4H in complex with RSR substrate
3b7t		[E296Q]LTA4H in complex with Arg-Ala-Arg substrate
3b7u		Leukotriene A4 Hydrolase Complexed with KELatorphan
3cho		Crystal structure of leukotriene a4 hydrolase in complex with 2-amino-N-[4-(phenylmethoxy)phenyl]-acetamide
3chp		Crystal structure of leukotriene a4 hydrolase in complex with (3S)-3-amino-4-oxo-4-[(4-phenylmethoxyphenyl)amino]butanoic acid
3chq		Crystal structure of leukotriene a4 hydrolase in complex with N5-[4-(phenylmethoxy)phenyl]-L-glutamine
3chr		Crystal structure of leukotriene A4 hydrolase in complex with 4-amino-N-[4-(phenylmethoxy)phenyl]-butanamide
3chs		Crystal structure of leukotriene A4 hydrolase in complex with (2S)-2-amino-5-[[4-[(2S)-2-hydroxy-2-phenyl-ethoxy]phenyl]amino]-5-oxo-pentanoic acid
3cia		Crystal structure of cold-aminopeptidase from Colwellia psychrerythraea
3fh5		Leukotriene A4 Hydrolase complexed with inhibitor (2R)-2-[(4-benzylphenoxy)methyl]pyrrolidine.
3fh7		Leukotriene A4 Hydrolase complexed with inhibitor 4-[(2S)-2-{[4-(4-chlorophenoxy)phenoxy]methyl}pyrrolidin-1-yl]butanoate.
3fh8		Leukotriene A4 Hydrolase complexed with inhibitor 1-[2-(4-benzylphenoxy)ethyl]pyrrolidine.
3fhe		Leukotriene A4 Hydrolase complexed with inhibitor N-[3-(4-benzylphenoxy)propyl]-N-methyl-beta-alanine.
3fts		Leukotriene A4 hydrolase in complex with resveratrol
3ftu		Leukotriene A4 hydrolase in complex with dihydroresveratrol
3ftv		Leukotriene A4 hydrolase in complex with fragment N-(pyridin-3-ylmethyl)aniline
3ftw		Leukotriene A4 hydrolase in complex with fragments N-(pyridin-3-ylmethyl)aniline and acetate
3ftx		Leukotriene A4 hydrolase in complex with dihydroresveratrol and bestatin
3fty		Leukotriene A4 hydrolase in complex with fragment 3-(benzyloxy)pyridin-2-amine
3ftz		Leukotriene A4 hydrolase in complex with fragment 2-(pyridin-3-ylmethoxy)aniline
3fu0		Leukotriene A4 hydrolase in complex with fragment 4-(4-fluorobenzoyl)pyridine
3fu3		Leukotriene A4 hydrolase in complex with fragment 4-(2-amino-1,3-thiazol-4-yl)phenol
3fu5		Leukotriene A4 hydrolase in complex with (5-thiophen-2-ylthiophen-2-yl)methylamine
3fu6		Leukotriene A4 hydrolase in complex with fragment (4-thiophen-2-ylphenyl)methanamine
3fud		Leukotriene A4 hydrolase in complex with N-methyl-1-(2-thiophen-2-ylphenyl)methanamine
3fue		Leukotriene A4 hydrolase in complex with fragment 5-chloroindole and bestatin
3fuf		Leukotriene A4 hydrolase in complex with fragment 5-fluoroindole and bestatin
3fuh		Leukotriene A4 hydrolase in complex with fragment 5-hydroxyindole and bestatin
3fui		Leukotriene A4 hydrolase in complex with N-benzyl-4-[(2R)-pyrrolidin-2-ylmethoxy]aniline
3fuj		Leukotriene A4 hydrolase in complex with 5-[2-(1H-pyrrol-1-yl)ethoxy]-1H-indole
3fuk		Leukotriene A4 hydrolase in complex with 1-[2-(1H-indol-5-yloxy)ethyl]piperidine-4-carboxylic acid
3ful		Leukotriene A4 hydrolase in complex with pyridin-4-yl[4-(2-pyrrolidin-1-ylethoxy)phenyl]methanone
3fum		Leukotriene A4 hydrolase in complex with (R)-pyridin-4-yl[4-(2-pyrrolidin-1-ylethoxy)phenyl]methanol
3fun		Leukotriene A4 hydrolase in complex with {4-[(2R)-pyrrolidin-2-ylmethoxy]phenyl}(4-thiophen-3-ylphenyl)methanone
3u9w		Structure of human Leukotriene A4 hydrolase in complex with inhibitor sc57461A
4dpr		Structure of human Leukotriene A4 hydrolase in complex with inhibitor captopril
4gaa		Structure of Leukotriene A4 hydrolase from Xenopus laevis complexed with inhibitor bestatin
4l2l		Human Leukotriene A4 Hydrolase complexed with ligand 4-(4-benzylphenyl)thiazol-2-amine
4mkt		Human Leukotriene A4 Hydrolase in complex with Pro-Gly-Pro analogue and 4-(4-benzylphenyl)thiazol-2-amine
4ms6		Human Leukotriene A4 Hydrolase in complex with Pro-Gly-Pro analogue
4r7l		4R7L
4rsy		4RSY
4rvb		4RVB
5aen		5AEN
5bpp		5BPP
5fwq		5FWQ

Links (links to other resources describing this domain)
PFAM Leuk-A4-hydro_C
INTERPRO IPR015211

The domain within your query sequence starts at position 675 and ends at position 821; the E-value for the Leuk-A4-hydro_C domain shown below is 3.02e-37.

Leuk-A4-hydro_C

Taxonomic distribution of proteins containing Leuk-A4-hydro_C domain.

3D Structures of Leuk-A4-hydro_C domains in PDB