The domain within your query sequence starts at position 445 and ends at position 509; the E-value for the Lig_chan-Glu_bd domain shown below is 5.77e-34.

PFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWNGMV
KELID

Lig_chan-Glu_bd

Ligated ion channel L-glutamate- and glycine-binding site
Lig_chan-Glu_bd
SMART accession number:SM00918
Description: This region, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and it binds L-glutamate and glycine. It is found in association with Lig_chan.
Interpro abstract (IPR019594):

This region, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine in the ionotropic glutamate receptor NMDA [ (PUBMED:10465381) (PUBMED:8428958) ]. It is found in association with IPR001320 .

Ionotropic Receptors (IRs) are a variant subfamily of the Ionotropic glutamate receptors (iGluRs). In IRs, the ligand binding domain lacks one or more residues that directly contact the glutamate ligand in iGluRs [ (PUBMED:20808886) ].

GO component:membrane (GO:0016020)
GO function:ionotropic glutamate receptor activity (GO:0004970)
Family alignment:
View or

There are 12153 Lig_chan-Glu_bd domains in 11972 proteins in SMART's nrdb database.

Click on the following links for more information.