The domain within your query sequence starts at position 118 and ends at position 161; the E-value for the LysM domain shown below is 2.24e-7.

EYTAGSQDTLNSVALKFNVTPNKLVELNKLFTHTIVPGQVLFVP

LysM

Lysin motif
LysM
SMART accession number:SM00257
Description: -
Interpro abstract (IPR018392):

The LysM (lysin motif) domain is a small globular domain, approximately 40 amino acids long. It is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls [ (PUBMED:1352512) ], but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis [ (PUBMED:15120137) ]. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes [ (PUBMED:10369758) ].

Family alignment:
View or

There are 136958 LysM domains in 89509 proteins in SMART's nrdb database.

Click on the following links for more information.