The domain within your query sequence starts at position 908 and ends at position 955; the E-value for the Matrilin_ccoil domain shown below is 7.77e-14.

PLEESQDQCKCENLILFQNVANEEVRKLTQRLLEEMTQRMEALENRLK

Matrilin_ccoil

Trimeric coiled-coil oligomerisation domain of matrilin
Matrilin_ccoil
SMART accession number:SM01279
Description: This short domain is a coiled coil structure and has a single cysteine residue at the start which is likely to form a di-sulfide bridge with a corresponding cysteine in an upstream EGF (SM00181) domain thereby spanning a VWA (SM00327) domain. All three domains can be associated together as in the cartilage matrix protein matrilin, where this domain is likely to be responsible for oligomerisation PMID:9287130.
Interpro abstract (IPR019466):

This entry represents a short domain found the matrilin (cartilage matrix) proteins. It forms a coiled coil structure and contains a single cysteine residue at its start which is likely to form a di-sulphide bridge with a corresponding cysteine in an upstream EGF domain, thereby spanning the VWA domain of the protein ( IPR002035 ).This domain is likely to be responsible for protein trimerisation [ (PUBMED:9287130) (PUBMED:9260286) ].

Family alignment:
View or

There are 1789 Matrilin_ccoil domains in 1789 proteins in SMART's nrdb database.

Click on the following links for more information.