The domain within your query sequence starts at position 30 and ends at position 200; the E-value for the Mob1_phocein domain shown below is 6.1e-85.

HTKSRITDFEFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTISEFCTGETCQTMAVC
NTQYYWYDERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTKYGREFPSSFESLVKKICK
YLFHVLGHIYWAHFKETLALELHGHLNTLYVHFILFAREFNLLDPKETAVM

Mob1_phocein

Mob1/phocein family
Mob1_phocein
SMART accession number:SM01388
Description: Mob1 is an essential Saccharomyces cerevisiae protein, identified from a two-hybrid screen, that binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Mob1 contains no known structural motifs; however MOB1 is a member of a conserved gene family and shares sequence similarity with a nonessential yeast gene, MOB2. Mob1 is a phosphoprotein in vivo and a substrate for the Mps1p kinase in vitro. Conditional alleles of MOB1 cause a late nuclear division arrest at restrictive temperature (PMID:9436989). This family also includes phocein Q9QYW3 a rat protein that by yeast two hybrid interacts with striatin (PMID:11251078).
Interpro abstract (IPR005301):

The MOB kinase activator family includes MOB1, an essential Saccharomyces cerevisiae protein, identified from a two-hybrid screen, that binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Conditional alleles of MOB1 cause a late nuclear division arrest at restrictive temperature [ (PUBMED:9436989) ]. This family also includes the MOB-like protein phocein, an intracellular protein that interacts with striatin and may play a role in membrane trafficking [ (PUBMED:11872741) ].

Family alignment:
View or

There are 5928 Mob1_phocein domains in 5923 proteins in SMART's nrdb database.

Click on the following links for more information.