The domain within your query sequence starts at position 62 and ends at position 170; the E-value for the Mre11_DNA_bind domain shown below is 1.81e-32.

MNMQKLPLRTVRRFFIEDVVLANHPNLFNPDNPKVTQAIQSFCLEKIEEMLDSAERERLG
NPQQPGKPLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHR

Mre11_DNA_bind

Mre11 DNA-binding presumed domain
Mre11_DNA_bind
SMART accession number:SM01347
Description: The Mre11 complex is a multi-subunit nuclease that is composed of Mre11, Rad50 and Nbs1/Xrs2, and is involved in checkpoint signalling and DNA replication (PMID:11988766). Mre11 has an intrinsic DNA-binding activity that is stimulated by Rad50 on its own or in combination with Nbs1 (PMID:10823903).
Interpro abstract (IPR007281):

The Mre11 complex is a multi-subunit nuclease that is composed of Mre11, Rad50 and Nbs1/Xrs2, and is involved in checkpoint signalling and DNA replication [ (PUBMED:11988766) ]. Mre11 has an intrinsic DNA-binding activity that is stimulated by Rad50 on its own or in combination with Nbs1 [ (PUBMED:10823903) ].

GO process:double-strand break repair (GO:0006302)
GO component:nucleus (GO:0005634)
GO function:endonuclease activity (GO:0004519), manganese ion binding (GO:0030145)
Family alignment:
View or

There are 1809 Mre11_DNA_bind domains in 1809 proteins in SMART's nrdb database.

Click on the following links for more information.