The domain within your query sequence starts at position 5 and ends at position 139; the E-value for the MutL_C domain shown below is 1.78e-1.

WTSMLRMRSTTLRCCSSTRCSRRRGSSRGCTQASEFPGPQTLNLTAVNEAVLIENLEIFR
KNGFDFVIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLSDSPGVMCRPSRVRQMF
ASRACRKSVKPIRAL

MutL_C

MutL C terminal dimerisation domain
MutL_C
SMART accession number:SM00853
Description: MutL and MutS are key components of the DNA repair machinery that corrects replication errors. MutS recognises mispaired or unpaired bases in a DNA duplex and in the presence of ATP, recruits MutL to form a DNA signaling complex for repair. The N terminal region of MutL contains the ATPase domain and the C terminal is involved in dimerisation.
Interpro abstract (IPR014790):

MutL and MutS are key components of the DNA repair machinery that corrects replication errors [ (PUBMED:8811176) ]. MutS recognises mispaired or unpaired bases in a DNA duplex and in the presence of ATP, recruits MutL to form a DNA signalling complex for repair. The N-terminal region of MutL contains the ATPase domain and the C-terminal is involved in dimerisation [ (PUBMED:15470502) ].

GO process:mismatch repair (GO:0006298)
GO function:ATP binding (GO:0005524)
Family alignment:
View or

There are 20111 MutL_C domains in 20108 proteins in SMART's nrdb database.

Click on the following links for more information.