The domain within your query sequence starts at position 1619 and ends at position 1679; the E-value for the NODP domain shown below is 1.66e-22.

EVIGSKIFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVFSELESPRNA
Q

NODP

NODP
SMART accession number:SM01339
Description: NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals (PMID:10221902, 11112321). NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologs in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. The role of the NOD and NODP domains remains to be elucidated.
Interpro abstract (IPR011656):

NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals [ (PUBMED:10221902) ]. NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologues in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. The role of the NOD and NODP domains remains to be elucidated.

GO process:cell differentiation (GO:0030154), multicellular organism development (GO:0007275), Notch signaling pathway (GO:0007219)
GO component:integral component of membrane (GO:0016021)
Family alignment:
View or

There are 1595 NODP domains in 1593 proteins in SMART's nrdb database.

Click on the following links for more information.