The domain within your query sequence starts at position 167 and ends at position 219; the E-value for the NOSIC domain shown below is 1.18e-30.

MIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIVNDNATYCRLAQFIGN

NOSIC

NOSIC (NUC001) domain
NOSIC
SMART accession number:SM00931
Description: This is the central domain in Nop56/SIK1-like proteins (PUBMED:15112237).
Interpro abstract (IPR012976):

This is the central domain in Nop56/SIK1-like proteins [ (PUBMED:15112237) ].

Family alignment:
View or

There are 5428 NOSIC domains in 5423 proteins in SMART's nrdb database.

Click on the following links for more information.