The domain within your query sequence starts at position 1810 and ends at position 2206; the E-value for the NUC194 domain shown below is 2.37e-246.
NVTRQAFVDRSLLTLLWHCDLDTLKEFFSRIVVDAIDVLKSRFTKLNEFTFDTQITKKMC YYKMLAVMYSRLLKDDVHSKEAKINQAFHGSRVAEGNELTKTLLKLCHDAFTENMVGESQ LLEKRRLYHCAAYNCAISLISCVFNELKFYQGFLFNEKPEKNLFIFENLIDLKRCYTFPI EVEVPMERKKKYIEIRKEARDAANGASGSPHYMSSLSYLTDSSLSEEMSQFDFSTGVQSY SYSSQDRKPTTGHFQRREHQDSMTQDDIMELEMDELNQHECMAPMIALIKHMQRNVIAPK GEEGSIPKDLPPWMKFLHDKLGNASVSLNIRLFLAKLVINTEEVFRPYAKHWLSPLLQLA VCENNREGIHYMMVEIVATILSWTGLATPTGVPKDEV
NUC194 |
---|
SMART accession number: | SM01344 |
---|---|
Description: | This is domain B in the catalytic subunit of DNA-dependent protein kinases. |
Interpro abstract (IPR012582): | Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity [ (PUBMED:3291115) ]:
Protein kinase function is evolutionarily conserved from Escherichia coli to human [ (PUBMED:12471243) ]. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation [ (PUBMED:12368087) ]. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [ (PUBMED:15078142) ], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases [ (PUBMED:15320712) ]. This is domain B in the catalytic subunit of DNA-dependent protein kinases. |
GO process: | double-strand break repair via nonhomologous end joining (GO:0006303) |
GO component: | nucleus (GO:0005634) |
GO function: | DNA binding (GO:0003677), DNA-dependent protein kinase activity (GO:0004677), ATP binding (GO:0005524) |
Family alignment: |
There are 703 NUC194 domains in 703 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Links (links to other resources describing this domain)