The domain within your query sequence starts at position 17 and ends at position 295; the E-value for the OSTEO domain shown below is 2.21e-158.
LPVKVTDSGSSEEKKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKDDFKQETLPS NSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDETVTASTQADTFTPIV PTVDVPNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKSGESKESLDVIPVAQL LSMPSDQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQS HKFHSHKDKLVLDPKSKEDDRYLKFRISHELESSSSEVN
OSTEOOsteopontin |
---|
SMART accession number: | SM00017 |
---|---|
Description: | Osteopontin is an acidic phosphorylated glycoprotein of about 40 Kd which is abundant in the mineral matrix of bones and which binds tightly to hydroxyapatite [1,2,3]. It is suggested that osteopontin might function as a cell attachment factor and could play a key role in the adhesion of osteoclasts to the mineral matrix of bone |
Interpro abstract (IPR002038): | The major event of endochondrial ossification is the proteolytic degradation of calcified cartilage and the extracellular matrix, and their substitution with bone-specific extracellular matrix produced and organised by osteoblasts [ (PUBMED:2033080) ]. One of the most abundant products of osteoblasts is osteopontin, a glycosylated phosphoprotein with a high acidic amino acid content and one copy of the cell attachment sequence RGD [ (PUBMED:2033080) ]. It is thought that osteopontin may act as a bridge between osteoblasts and the apatite mineral of the bone [ (PUBMED:2033080) ]. Osteopontin-K is a kidney protein, similar to osteopontin and probably also involved in cell adhesion [ (PUBMED:1414488) ]. |
GO process: | cell adhesion (GO:0007155), ossification (GO:0001503) |
Family alignment: |
There are 184 OSTEO domains in 184 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Links (links to other resources describing this domain)