The domain within your query sequence starts at position 393 and ends at position 436; the E-value for the PAC domain shown below is 1.6e0.

YSPIRFRTRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGP

PAC

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain)
PAC
SMART accession number:SM00086
Description: PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.
Interpro abstract (IPR001610):

PAC motifs occur C-terminal to a subset of all known PAS motifs (see IPR000014 ). It is proposed to contribute to the PAS domain fold [ (PUBMED:9301332) (PUBMED:7756254) (PUBMED:9382818) ].

Family alignment:
View or

There are 401760 PAC domains in 251051 proteins in SMART's nrdb database.

Click on the following links for more information.