The domain within your query sequence starts at position 280 and ends at position 333; the E-value for the PADR1 domain shown below is 1.48e-28.

ILDRVADGMAFGALLPCKECSGQLVFKSDAYYCTGDVTAWTKCMVKTQNPSRKE

PADR1

PADR1
SMART accession number:SM01335
Description: This domain is found in poly(ADP-ribose)-synthetases (PMID:15112237). The function of this domain is unknown.
Interpro abstract (IPR012982):

This domain is found in poly(ADP-ribose)-synthetases [ (PUBMED:15112237) ]. The function of this domain is unknown.

Family alignment:
View or

There are 1059 PADR1 domains in 1055 proteins in SMART's nrdb database.

Click on the following links for more information.