The domain within your query sequence starts at position 75 and ends at position 189; the E-value for the PCRF domain shown below is 2.26e-36.
ESLLHDENEDLKKLAESEIALCQKQITELKHQIISLLVPSEEMDGSDLILEVTAGVGGQE AMLFTSEMFDMYQQYAAFKRWHFETLEYFPSELGGLRHASASVGGPEAYRHMKFE
PCRF |
---|
SMART accession number: | SM00937 |
---|---|
Description: | This domain is found in peptide chain release factors. |
Interpro abstract (IPR005139): | This domain is found in bacterial, mitochondrial and chloroplastic peptide chain release factors. In bacteria, termination of protein synthesis depends on the type I release factors, RF1 and RF2 [ (PUBMED:2215213) ]. Both contain this domain. |
GO process: | translational termination (GO:0006415) |
Family alignment: |
There are 39330 PCRF domains in 39328 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)