SMART: PDB domain 4cdk

The domain within your query sequence starts at position 53 and ends at position 205; the E-value for the 4cdk domain shown below is 1e-111.

KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDL
YEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDP
LKRPVVYVKGADAIKLMNIVNKQKVARARIQHL

The domain within your query sequence starts at position 53 and ends at position 205; the E-value for the 4cdk domain shown below is 1e-111.

This is a PDB domain - please see the PDBSUM entry of 4cdk for further annotation