The domain within your query sequence starts at position 168 and ends at position 410; the E-value for the PP2C_SIG domain shown below is 5.13e-5.

DRHVSLPAFNHLFGLSDSVHRAYFAVFDGHGGVDAARYASVHVHTNASHQPELRTNPAAA
LKEAFRLTDEMFLQKAKRERLQSGTTGVCALIAGAALHVAWLGDSQVILVQQGRVVKLME
PHKPERQDEKARIEALGGFVSLMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRELTG
SEDYLLLACDGFFDVVPHHEVTGLVHGHLLRHKGNGMRIAEELVAVARDRGSHDNITVMV
VFL

PP2C_SIG

Sigma factor PP2C-like phosphatases

• SMART accession number: SM00331
• Description: -
• Interpro abstract (IPR001932):

  Protein phosphatases remove phosphate groups from various proteins that are the key components of a number of signalling pathways in eukaryotes and prokaryotes. Protein phosphatases that dephosphorylate Ser and Thr residues are classified into the phosphoprotein (PPP) and the protein phosphatase Mg(2+)- or Mn(2+)-dependent (PPM) families. The core structure of PPMs is the 300-residue PPM-type phosphatase domain that catalyses the dephosphorylation of phosphoserine- and phosphothreonine-containing protein. The PPM-type phosphatase domain is found as a module in diverse structural contexts and is modulated by targeting and regulatory subunits [ (PUBMED:9003755) (PUBMED:9869399) (PUBMED:22115775) (PUBMED:22668558) ].

  Some proteins known to contain a PPM-type phosphatase domain are listed below:

  • Bacillus subtilis stage II sporulation protein E (SpoIIE), controls the sporulation by dephosphorylating an anti-transcription factor SpoIIAA, reversing the actions of the SpoIIAB protein kinase in a process that is governed by the ADP/ATP ratio [levdikov].
  • Mycobacterium tuberculosis PP2C-family Ser/Thr phosphatase (PstP).
  • Eucaryotic PP2C, a negative regulator of protein kinase cascades that are activated as a result of stress.
  • Yeast adenyl cyclase, plays essential roles in regulation of cellular metabolism by catalysing the synthesis of a second messenger, cAMP.
  • Mammalian mitochondrial pyruvate dehydrogenase phosphatase 1 (PDP1).
  • Plant kinase-associated protein phosphatase (KAPP), regulates receptor-like kinase (RLK) signalling pathways.
  • Plant absissic acid-insenstive 1 and 2 (ABI1 and ABI2), play a key absissic acid (ABA) signal transduction.

  The PP2C-type phosphatase domain consists of 10 segments of beta-strands and 5 segments of alpha-helix and comprises a pair of detached subdomains. The first is a small beta-sandwich with strand beta1 packed against strands beta2 and beta3; the second is a larger beta-sandwich in which a four-stranded beta-sheet packs against a three-stranded beta-sheet with flanking alpha-helices [ (PUBMED:9003755) (PUBMED:22115775) ].

  This entry represents a conserved region found in the N-terminal part that contains a perfectly conserved tripeptide.

• GO function: phosphatase activity (GO:0016791)

There are 114813 PP2C_SIG domains in 114809 proteins in SMART's nrdb database.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
21.43	map04010	MAPK signaling pathway
8.93	map00562	Inositol phosphate metabolism
8.93	map00760	Nicotinate and nicotinamide metabolism
8.93	map00632	Benzoate degradation via CoA ligation
8.93	map00740	Riboflavin metabolism
8.93	map00530	Aminosugars metabolism
8.93	map00730	Thiamine metabolism
8.93	map00051	Fructose and mannose metabolism
7.14	map00260	Glycine, serine and threonine metabolism
5.36	map04115	p53 signaling pathway
1.79	map00230	Purine metabolism
1.79	map02020	Two-component system - General

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with PP2C_SIG domain which could be assigned to a KEGG orthologous group, and not all proteins containing PP2C_SIG domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of PP2C_SIG domains in PDB

PDB code	Title
1a6q	CRYSTAL STRUCTURE OF THE PROTEIN SERINE/THREONINE PHOSPHATASE 2C AT 2 A RESOLUTION
1txo	Crystal structure of the Mycobacterium tuberculosis serine/threonine phosphatase PstP/Ppp at 1.95 A.
2cm1	Crystal structure of the catalytic domain of serine threonine protein phosphatase PstP in complex with 2 Manganese ions.
2i0o	Crystal structure of Anopheles gambiae Ser/Thr phosphatase complexed with Zn2+
2i44	Crystal structure of serine-threonine phosphatase 2C from Toxoplasma gondii
2iq1	Crystal structure of human PPM1K
2isn	Crystal structure of a phosphatase from a pathogenic strain Toxoplasma gondii
2j82	Structural analysis of the PP2C Family Phosphatase tPphA from Thermosynechococcus elongatus
2j86	Structural analysis of the PP2C Family Phosphatase tPphA of Thermosynechococcus elongatus
2jfr	Crystal structure of the PP2C Ser-Thr phosphatase MsPP from Mycobacterium smegmatis in complex with phosphate at 0.83 A resolution
2jfs	Crystal structure of the PPM Ser-Thr phosphatase MsPP from Mycobacterium smegmatis in complex with cacodylate
2jft	Crystal structure of the PPM Ser-Thr phosphatase MsPP from Mycobacterium smegmatis in complex with sulfate
2p8e	Crystal structure of the serine/threonine phosphatase domain of human PPM1B
2pk0	Structure of the S. agalactiae serine/threonine phosphatase at 2.65 resolution
2pnq	Crystal structure of pyruvate dehydrogenase phosphatase 1 (PDP1)
2v06	Crystal structure of the PPM Ser-Thr phosphatase MsPP from Mycobacterium smegmatis at pH 5.5
2xzv	The cyanobacterial PP2C-like phosphatase tPphA requires three metals in the catalytic center for efficient catalysis
2y09	The cyanobacterial PP2C-like phosphatase tPphA requires three metals in the catalytic center for efficient catalysis
3eq2	Structure of Hexagonal Crystal form of Pseudomonas aeruginosa RssB
3es2	Structure of the C-terminal phosphatase domain of P. aeruginonsa RssB
3f79	Structure of pseudo-centered cell crystal form of the C-terminal phosphatase domain of P. aeruginosa RssB
3f7a	Structure of Orthorhombic crystal form of Pseudomonas aeruginosa RssB
3fxj	Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Phosphate at 3 mM of Mn2+
3fxk	Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Phosphate at 10 mM of Mn2+
3fxl	Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Citrate at 1 mM of Mn2+
3fxm	Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Citrate at 10 mM of Mn2+
3fxo	Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Phosphate at 1 mM of Mn2+
3jrq	Crystal structure of (+)-ABA-bound PYL1 in complex with ABI1
3kb3	Crystal structure of abscisic acid-bound PYL2 in complex with HAB1
3kdj	Complex structure of (+)-ABA-bound PYL1 and ABI1
3ke6	The crystal structure of the RsbU and RsbW domains of Rv1364c from Mycobacterium tuberculosis
3mq3	Crystal structure of native bovine PDP1c
3n3c	Crystal structure of native bovine PDP1c
3nmn	Crystal structure of pyrabactin-bound abscisic acid receptor PYL1 in complex with type 2C protein phosphatase ABI1
3nmt	Crystal structure of pyrabactin bound abscisic acid receptor PYL2 mutant A93F in complex with type 2C protein phosphatase HAB1
3nmv	Crystal structure of pyrabactin-bound abscisic acid receptor PYL2 mutant A93F in complex with type 2C protein phosphatase ABI2
3pu9	Crystal structure of serine/threonine phosphatase Sphaerobacter thermophilus DSM 20745
3qn1	Crystal structure of the PYR1 Abscisic Acid receptor in complex with the HAB1 type 2C phosphatase catalytic domain
3rnr	Crystal Structure of Stage II Sporulation E Family Protein from Thermanaerovibrio acidaminovorans
3rt0	Crystal structure of PYL10-HAB1 complex in the absence of abscisic acid (ABA)
3t91	Structure of the Phosphatase Domain of the Cell Fate Determinant SpoIIE from Bacillus subtilis
3t9q	Structure of the Phosphatase Domain of the Cell Fate Determinant SpoIIE from Bacillus subtilis (Mn presoaked)
3ujg	Crystal structure of SnRK2.6 in complex with HAB1
3ujk	Crystal structure of protein phosphatase ABI2
3ujl	Crystal structure of abscisic acid bound PYL2 in complex with type 2C protein phosphatase ABI2
3w40	Crystal structure of RsbX in complex with magnesium in space group P1
3w41	Crystal structure of RsbX in complex with magnesium in space group P21
3w42	Crystal structure of RsbX in complex with manganese in space group P1
3w43	Crystal structure of RsbX in complex with manganese in space group P21
3w44	Crystal structure of RsbX, selenomethionine derivative
3w45	Crystal structure of RsbX in complex with cobalt in space group P1
3zt9	The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling
3zvu	Structure of the PYR1 His60Pro mutant in complex with the HAB1 phosphatase and Abscisic acid
4da1	Crystal structure of branched-chain alpha-ketoacid dehydrogenase phosphatase with Mg (II) ions at the active site
4ds8	Complex structure of abscisic acid receptor PYL3-(+)-ABA-HAB1 in the presence of Mn2+
4jnd	Structure of a C.elegans sex determining protein
4la7	X-ray crystal structure of the PYL2-quinabactin-Hab1 ternary complex
4lg5	ABA-mimicking ligand QUINABACTIN in complex with ABA receptor PYL2 and PP2C HAB1
4lga	ABA-mimicking ligand N-(2-OXO-1-PROPYL-1,2,3,4-TETRAHYDROQUINOLIN-6-YL)-1-PHENYLMETHANESULFONAMIDE in complex with ABA receptor PYL2 and PP2C HAB1
4lgb	ABA-mimicking ligand N-(1-METHYL-2-OXO-1,2,3,4-TETRAHYDROQUINOLIN-6-YL)-1-(4-METHYLPHENYL)METHANESULFONAMIDE in complex with ABA receptor PYL2 and PP2C HAB1
4n0g	Crystal Structure of PYL13-PP2CA complex
4oic	4OIC
4ra2	4RA2
4raf	4RAF
4rag	4RAG
4wvo	4WVO
4yzg	4YZG
4yzh	4YZH
5d2u	5D2U
5f1m	5F1M
5iti	5ITI
5jo1	5JO1
5jo2	5JO2

Links (links to other resources describing this domain)

• INTERPRO: IPR001932