The domain within your query sequence starts at position 26 and ends at position 136; the E-value for the PTPc_DSPc domain shown below is 4e-4.

HAVEVRPGLYLGGAAAVAEPGHLREAGITAVLTVDSEPAFPAGAGFEGLRSLFVPALDKP
ETDLLSHLDRCVAFIGQARSEGRAVLVHWSLFQSCRSQSQCCCSDGFYNED

PTPc_DSPc

Protein tyrosine phosphatase, catalytic domain, undefined specificity
PTPc_DSPc
SMART accession number:SM00012
Description: Protein tyrosine phosphatases. Homologues detected by this profile and not by those of "PTPc" or "DSPc" are predicted to be protein phosphatases with a similar fold to DSPs and PTPs, yet with unpredicted specificities.
Family alignment:
View or

There are 306 PTPc_DSPc domains in 296 proteins in SMART's nrdb database.

Click on the following links for more information.