The domain within your query sequence starts at position 93 and ends at position 171; the E-value for the PUA domain shown below is 3.41e-13.

PHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYTAAVDTIVAVMAEGKEHALCVGVMKMAA
ADIEKINKGIGIENIHYLN

PUA

Putative RNA-binding Domain in PseudoUridine synthase and Archaeosine transglycosylase
PUA
SMART accession number:SM00359
Description: -
Interpro abstract (IPR002478):

The PUA (PseudoUridine synthase and Archaeosine transglycosylase) domain was named after the proteins in which it was first found [ (PUBMED:10093218) ]. PUA is a highly conserved RNA-binding motif found in a wide range of archaeal, bacterial and eukaryotic proteins, including enzymes that catalyse tRNA and rRNA post-transcriptional modifications, proteins involved in ribosome biogenesis and translation, as well as in enzymes involved in proline biosynthesis [ (PUBMED:16793063) (PUBMED:16407303) ]. The structures of several PUA-RNA complexes reveal a common RNA recognition surface, but also some versatility in the way in which the motif binds to RNA [ (PUBMED:17803682) ]. PUA motifs are involved in dyskeratosis congenita and cancer, pointing to links between RNA metabolism and human diseases [ (PUBMED:16943774) ].

GO function:RNA binding (GO:0003723)
Family alignment:
View or

There are 27311 PUA domains in 27309 proteins in SMART's nrdb database.

Click on the following links for more information.