The domain within your query sequence starts at position 1058 and ends at position 1141; the E-value for the PWWP domain shown below is 2.25e-39.
LEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSEEKL FLVLFFDNKRSWQWLPKSKMVPLG
PWWPdomain with conserved PWWP motif |
---|
SMART accession number: | SM00293 |
---|---|
Description: | conservation of Pro-Trp-Trp-Pro residues |
Interpro abstract (IPR000313): | The PWWP domain is an around 70 amino acids domain that was named after its central core 'Pro-Trp-Trp-Pro'. The PWWP domain is found in one or, less frequently, in two copies in nuclear, often DNA-binding proteins that function as transcription factors regulating developmental processes. Due to its position, the composition of amino acids close to the PWWP motif and the pattern of other domains present, it has been proposed that the PWWP domain is involved in protein-protein interactions [ (PUBMED:10802047) (PUBMED:28645917) ]. The structure of the PWWP domain comprises a five-stranded beta-barrel followed by a five-helix bundle [ (PUBMED:11836534) ]. Conservation of the PWWP domain is concentrated on one major and two minor blocks with length differences occurring in between [ (PUBMED:10802047) ]. |
Family alignment: |
There are 7446 PWWP domains in 6224 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)