SMART: PXA domain annotation

The domain within your query sequence starts at position 97 and ends at position 284; the E-value for the PXA domain shown below is 9.09e-102.

GANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQP
YFTTRIVDDFGTHLRVFRKAQQRVTEKDDQVKGTAEDLVETFFEVEVEMEKDVCRDLVCT
SPKDEEGFLRDLCEVLLYLLLPPGDFQSKIMRYFVREILARGILLPLINQLSDPDYINQY
VIWMIRDS

PXA Domain associated with PX domains

SMART accession number:	SM00313
Description:	unpubl. observations
Interpro abstract (IPR003114):	This domain is found associated with PX domains. The PX (phox) domain [ (PUBMED:8931154) ] occurs in a variety of eukaryotic proteins associated with intracellular signalling pathways.
Family alignment:	View or

There are 356 PXA domains in 356 proteins in SMART's nrdb database.

Click on the following links for more information.

Evolution (species in which this domain is found)
Taxonomic distribution of proteins containing PXA domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with PXA domain is also avaliable.

Click on the protein counts, or double click on taxonomic names to display all proteins containing PXA domain in the selected taxonomic class.
Links (links to other resources describing this domain)
INTERPRO IPR003114

The domain within your query sequence starts at position 97 and ends at position 284; the E-value for the PXA domain shown below is 9.09e-102.

PXA

Taxonomic distribution of proteins containing PXA domain.