The domain within your query sequence starts at position 98 and ends at position 285; the E-value for the PXA domain shown below is 9.09e-102.
ANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPY FTTRIVDDFGTHLRVFRKAQQRVTEKDDQVKGTAEDLVETFFEVEVEMEKDVCRDLVCTS PKDEEGFLRDLCEVLLYLLLPPGDFQSKIMRYFVREILARGILLPLINQLSDPDYINQYV IWMIRDSN
PXADomain associated with PX domains |
---|
SMART accession number: | SM00313 |
---|---|
Description: | unpubl. observations |
Interpro abstract (IPR003114): | This domain is found associated with PX domains. The PX (phox) domain [ (PUBMED:8931154) ] occurs in a variety of eukaryotic proteins associated with intracellular signalling pathways. |
Family alignment: |
There are 356 PXA domains in 356 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)