The domain within your query sequence starts at position 19 and ends at position 85; the E-value for the 2-Hacid_dh domain shown below is 7.5e-7.

VALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTREDLEKF
KALRIIV

2-Hacid_dh

2-Hacid_dh
PFAM accession number:PF00389
Interpro abstract (IPR006139):

A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related. The catalytic domain contains a number of conserved charged residues which may play a role in the catalytic mechanism [ (PUBMED:9126843) ]. The NAD-binding domain is described in IPR006140 .

GO process:oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616), NAD binding (GO:0051287)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 2-Hacid_dh