The domain within your query sequence starts at position 114 and ends at position 298; the E-value for the 2-Hacid_dh_C domain shown below is 1.5e-57.

VCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVR
AKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTI
KQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLIC
TPHTA

2-Hacid_dh_C

• PFAM accession number: PF02826
• Interpro abstract (IPR006140):

  A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related. All contain a glycine-rich region located in the central section of these enzymes, this region corresponds to the NAD-binding domain. This domain is inserted into the catalytic domain. The catalytic domain is described in ( IPR006139 ).

• GO process: oxidation-reduction process (GO:0055114)
• GO function: NAD binding (GO:0051287)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 2-Hacid_dh_C