The domain within your query sequence starts at position 248 and ends at position 479; the E-value for the 2-oxoacid_dh domain shown below is 8.5e-83.
TGKDRTEPVTGFQKAMVKTMSAALKIPHFGYCDEIDLTQLVKLREELKPVALARGIKLSF MPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTELGLIVPNVKNVQVRSV FEIAMELNRLQKLGSSGQLGTTDLTGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGAIK ALPRFDQKGDVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLL
2-oxoacid_dh |
![]() |
---|
PFAM accession number: | PF00198 |
---|---|
Interpro abstract (IPR001078): | This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex EC 2.3.1 which catalyses the overall conversion of alpha-keto acids to acyl-CoA and carbon dioxide [ (PUBMED:8487300) ]. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3). The domain is also found in the dihydrolipoamide succinyltransferase component of the 2-oxoglutarate dehydrogenase complex EC 2.3.1.61 . These proteins contain one to three copies of a lipoyl binding domain followed by the catalytic domain. |
GO function: | transferase activity, transferring acyl groups (GO:0016746) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 2-oxoacid_dh