The domain within your query sequence starts at position 47 and ends at position 87; the E-value for the 2-oxogl_dehyd_N domain shown below is 6.6e-21.
EPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGA
2-oxogl_dehyd_N |
![]() |
---|
PFAM accession number: | PF16078 |
---|---|
Interpro abstract (IPR032106): | This domain is found at the N terminus of 2-oxoglutarate dehydrogenase component E1 [ (PUBMED:1505515) ]. 2-oxoglutarate dehydrogenase is a key enzyme in the TCA cycle, converting 2-oxoglutarate, coenzyme A and NAD(+) to succinyl-CoA, NADH and carbon dioxide [ (PUBMED:16321804) ]. This activity of this enzyme is tightly regulated and it is a major determinant of the metabolic flux through the TCA cycle. This enzyme is composed of multiple copies of three different subunits: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3) which is often shared with similar enzymes such as pyruvate dehydrogenase [ (PUBMED:9278141) ]. The E2 component forms a large multimeric core which binds the peripheral E1 and E3 subunits. The substrate is transferred between the active sites of the different subunits by a lipoyl moiety, bound to a lysine residue from the E2 polypeptide. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 2-oxogl_dehyd_N