The domain within your query sequence starts at position 544 and ends at position 639; the E-value for the 3HCDH domain shown below is 7.7e-29.

GFYTTRCLAPMMSEVMRILQEGVDPKKLDALTTGFGFPVGAATLADEVGVDVAQHVAEDL
GKAFGERFGGGSVELLKQMVSKGFLGRKSGKGFYIY

3HCDH

3HCDH
PFAM accession number:PF00725
Interpro abstract (IPR006108):

3-hydroxyacyl-CoA dehydrogenase ( EC 1.1.1.35 ) (HCDH) [ (PUBMED:3479790) ] is an enzyme involved in fatty acid metabolism, it catalyzes the reduction of 3-hydroxyacyl-CoA to 3-oxoacyl-CoA. Most eukaryotic cells have 2 fatty-acid beta-oxidation systems, one located in mitochondria and the other in peroxisomes. In peroxisomes 3-hydroxyacyl-CoA dehydrogenase forms, with enoyl-CoA hydratase (ECH) and 3,2-trans-enoyl-CoA isomerase (ECI) a multifunctional enzyme where the N-terminal domain bears the hydratase/isomerase activities and the C-terminal domain the dehydrogenase activity. There are two mitochondrial enzymes: one which is monofunctional and the other which is, like its peroxisomal counterpart, multifunctional.

In Escherichia coli (gene fadB) and Pseudomonas fragi (gene faoA) HCDH is part of a multifunctional enzyme which also contains an ECH/ECI domain as well as a 3-hydroxybutyryl-CoA epimerase domain [ (PUBMED:2204034) ].

There are two major region of similarities in the sequences of proteins of the HCDH family, the first one located in the N-terminal, corresponds to the NAD-binding site, the second one is located in the centre of the sequence. This represents the C-terminal domain which is also found in lambda crystallin. Some proteins include two copies of this domain.

GO process:fatty acid metabolic process (GO:0006631), oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity (GO:0016491), 3-hydroxyacyl-CoA dehydrogenase activity (GO:0003857)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 3HCDH