SMART: Pfam domain 4HBT

The domain within your query sequence starts at position 52 and ends at position 129; the E-value for the 4HBT domain shown below is 1.1e-19.

LGTLHGGLTATLVDSISTMALMCTERGAPGVSVDMNITYMSPAKIGEEIVITAHILKQGK
TLAFASVDLTNKTTGKLI

4HBT

PFAM accession number:	PF03061
Interpro abstract (IPR006683):	A wide variety of enzymes contain this domain, principally thioesterases. Proteins containing this domain include 4HBT (4-hydroxybenzoyl-CoA thioesterase) ( EC 3.1.2.23 ) which catalyses the final step in the biosynthesis of 4-hydroxybenzoate from 4-chlorobenzoate in the soil dwelling microbe Pseudomonas CBS-3 [ (PUBMED:9837940) (PUBMED:1610806) ]. It also includes various cytosolic long-chain acyl-CoA thioester hydrolases. Long-chain acyl-CoA hydrolases hydrolyse palmitoyl-CoA to CoA and palmitate, they also catalyse the hydrolysis of other long chain fatty acyl-CoA thioesters [ (PUBMED:8805534) ].

PFAM accession number:

PF03061

Interpro abstract (IPR006683):

A wide variety of enzymes contain this domain, principally thioesterases. Proteins containing this domain include 4HBT (4-hydroxybenzoyl-CoA thioesterase) ( EC 3.1.2.23 ) which catalyses the final step in the biosynthesis of 4-hydroxybenzoate from 4-chlorobenzoate in the soil dwelling microbe Pseudomonas CBS-3 [ (PUBMED:9837940) (PUBMED:1610806) ]. It also includes various cytosolic long-chain acyl-CoA thioester hydrolases. Long-chain acyl-CoA hydrolases hydrolyse palmitoyl-CoA to CoA and palmitate, they also catalyse the hydrolysis of other long chain fatty acyl-CoA thioesters [ (PUBMED:8805534) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 4HBT