The domain within your query sequence starts at position 9 and ends at position 206; the E-value for the 5-FTHF_cyc-lig domain shown below is 7.8e-32.
KQSIRERIWDYMESHDIADFPRPVHHRIPNFKGSYLAGQSIRDLEVFAGTQEVKVDPDKP LEGVRFLALQSKKTLLVPTPRLRTGLFNKITPPPGATKDILRKCATSQGVRNFSVPVGLD SSVLVDLVVVGSVAVSEKGWRIGKGEGYADLEYAMMVSMGAVHKGTPVVTIVHDCQVVDI PEALVEDHDLTVDYILTP
5-FTHF_cyc-lig |
![]() |
---|
PFAM accession number: | PF01812 |
---|---|
Interpro abstract (IPR002698): | 5-formyltetrahydrofolate cyclo-ligase or methenyl-THF synthetase EC 6.3.3.2 catalyses the interchange of 5-formyltetrahydrofolate (5-FTHF) to 5-10-methenyltetrahydrofolate, this requires ATP and Mg 2 [ (PUBMED:8522195) ]. 5-FTHF is used in chemotherapy where it is clinically known as Leucovorin [ (PUBMED:8034591) ]. This entry also includes the 5-formyltetrahydrofolate cyclo-ligase-like protein COG0212 (At1g76730) from Arabidopsis. It does not possess the 5-formyltetrahydrofolate cyclo-ligase activity in vitro and does not complement the growth defect or the characteristic 5- formyltetrahydrofolate accumulation of a 5-FCL-deficient Escherichia coli strain. Instead, it may play a role in thiamin metabolism [ (PUBMED:21538139) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 5-FTHF_cyc-lig