The domain within your query sequence starts at position 135 and ends at position 330; the E-value for the 60KD_IMP domain shown below is 4.1e-28.

WWGAIATCTVLARCLVFPLIVKGQREAAKIHNHMPEMQKFSARIREAKLAGDQAEFYKAT
IEMTRYQKKHDIKLLRPLILPLTQAPVFISFFIALREMANLPVPSLQTGGLWWFQDLTVS
DPIYVLPLVVTATMWCVLELGAETGVQSNDLQFMRNIIRVMPLVVLPVTIHFPSAVFMYW
LSSNVFSLCQVACLRI

60KD_IMP

60KD_IMP
PFAM accession number:PF02096
Interpro abstract (IPR001708):

This entry includes membrane insertase YidC from bacteria, ALBINO3-like proteins from plants, and mitochondrial membrane insertase OXA1 and cytochrome c oxidase assembly protein COX18 from eukaryotes. They are a group of evolutionarily conserved proteins that function in membrane protein integration and protein complex stabilization. They share a conserved region composed of five transmembrane regions [ (PUBMED:25947384) ].

YidC is required for the insertion of integral membrane proteins into the membrane. It may also be involved in protein secretion processes [ (PUBMED:29295859) ].

COX18 is a mitochondrial membrane insertase required for the translocation of the C terminus of cytochrome c oxidase subunit II (MT-CO2/COX2) across the mitochondrial inner membrane. It plays a role in MT-CO2/COX2 maturation following the COX20-mediated stabilization of newly synthesized MT-CO2/COX2 protein and before the action of the metallochaperones SCO1/2 [ (PUBMED:28330871) ].

OXA1 is a mitochondrial inner membrane insertase that mediates the insertion of both mitochondrion-encoded precursors and nuclear-encoded proteins from the matrix into the inner membrane. It links mitoribosomes with the inner membrane [ (PUBMED:22904327) ].

Plant ALBINO3-like proteins are required for the insertion of some light harvesting chlorophyll-binding proteins (LHCP) into the chloroplast thylakoid membrane [ (PUBMED:26265777) (PUBMED:19995738) ].

GO component:integral component of membrane (GO:0016021)
GO function:membrane insertase activity (GO:0032977)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 60KD_IMP