The domain within your query sequence starts at position 35 and ends at position 305; the E-value for the 7TM_GPCR_Srsx domain shown below is 2.1e-6.
YLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSILDLSSLSVTIPQYVDSSLARSGYISY AQCMLQIFFFASFAWGELGTLTVMSYDRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGGI SGTLFTASTLSIRFCGDKIIHQFFCDIPQLLKLSCSNDDFGVLEVSIFMAVMAFACFMGI AFSYGQIFSTVLRMPSAEGRSKVFSTCLPHLFVVSFFLSTGSCAYLKPTSDSPTASDLML SIFYTVLPPTLNPFIYSLRNKSLKEAVKKLL
7TM_GPCR_Srsx |
---|
PFAM accession number: | PF10320 |
---|---|
Interpro abstract (IPR019424): | Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [ (PUBMED:7585938) ]. Srsx is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' [ (PUBMED:18050473) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 7TM_GPCR_Srsx