The domain within your query sequence starts at position 874 and ends at position 1119; the E-value for the 7tm_2 domain shown below is 1.3e-72.

DLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIHKNLCISLFVAELLFLIGINR
TDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPAL
IVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAIL
KPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNS
LQGMFI

7tm_2

7tm_2
PFAM accession number:PF00002
Interpro abstract (IPR000832):

The secretin-like GPCRs include secretin [ (PUBMED:1646711) ], calcitonin [ (PUBMED:1658940) ], parathyroid hormone/parathyroid hormone-related peptides [ (PUBMED:1658941) ] and vasoactive intestinal peptide [ (PUBMED:1314625) ], all of which activate adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. These receptors contain seven transmembrane regions, in a manner reminiscent of the rhodopsins and other receptors believed to interact with G-proteins (however there is no significant sequence identity between these families, the secretin-like receptors thus bear their own unique '7TM' signature). Their N-terminal is probably located on the extracellular side of the membrane and potentially glycosylated. This N-terminal region contains a long conserved region which allows the binding of large peptidic ligand such as glucagon, secretin, VIP and PACAP; this region contains five conserved cysteines residues which could be involved in disulphide bond. The C-terminal region of these receptor is probably cytoplasmic. Every receptor gene in this family is encoded on multiple exons, and several of these genes are alternatively spliced to yield functionally distinct products.

G protein-coupled receptors (GPCRs) constitute a vast protein family that encompasses a wide range of functions, including various autocrine, paracrine and endocrine processes. They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups [ (PUBMED:12679517) ]. The term clan can be used to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence [ (PUBMED:8170923) ]. The currently known clan members include rhodopsin-like GPCRs (Class A, GPCRA), secretin-like GPCRs (Class B, GPCRB), metabotropic glutamate receptor family (Class C, GPCRC), fungal mating pheromone receptors (Class D, GPCRD), cAMP receptors (Class E, GPCRE) and frizzled/smoothened (Class F, GPCRF) [ (PUBMED:8170923) (PUBMED:8081729) (PUBMED:15914470) (PUBMED:18948278) (PUBMED:16753280) ]. GPCRs are major drug targets, and are consequently the subject of considerable research interest. It has been reported that the repertoire of GPCRs for endogenous ligands consists of approximately 400 receptors in humans and mice [ (PUBMED:12679517) ]. Most GPCRs are identified on the basis of their DNA sequences, rather than the ligand they bind, those that are unmatched to known natural ligands are designated by as orphan GPCRs, or unclassified GPCRs [ (PUBMED:23020293) ].

GO process:G protein-coupled receptor signaling pathway (GO:0007186)
GO component:integral component of membrane (GO:0016021)
GO function:G protein-coupled receptor activity (GO:0004930)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 7tm_2