The domain within your query sequence starts at position 7 and ends at position 155; the E-value for the AAA_16 domain shown below is 2.4e-15.
MVLCREAQVSTLQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHAFVNCVEC FTSRLLLEQILNKLSHLNSSDAGCSTEMTCETFNDFVQLFKQVTSAEHLKDQTVYIVLDK AEYLRDMEANLLPGLLRLQELTDRNVTVI
AAA_16 |
---|
PFAM accession number: | PF13191 |
---|---|
Interpro abstract (IPR041664): | This domain contains a P-loop motif that is characteristic of the AAA superfamily. This domain has been classified as AAA_16 in Pfam and can be found in the Origin Recognition Complex (ORC) subunits and serine/threonine-protein kinase PknK. The Origin Recognition Complex (ORC) is a six-subunit ATP-dependent DNA-binding complex encoded in yeast by ORC1-6 [ (PUBMED:17241905) ]. ORC is a central component for eukaryotic DNA replication, and binds chromatin at replication origins throughout the cell cycle [ (PUBMED:17825065) ]. ORC directs DNA replication throughout the genome and is required for its initiation [ (PUBMED:1579162) (PUBMED:7585959) (PUBMED:16716188) ]. ORC bound at replication origins serves as the foundation for assembly of the pre-replicative complex (pre-RC), which includes Cdc6, Tah11 (aka Cdt1), and the Mcm2-7 complex [ (PUBMED:7892251) (PUBMED:7781615) (PUBMED:16228006) ]. Pre-RC assembly during G1 is required for replication licensing of chromosomes prior to DNA synthesis during S phase [ (PUBMED:10966477) (PUBMED:12045100) (PUBMED:15680967) ]. Cell cycle-regulated phosphorylation of ORC2, ORC6, Cdc6, and MCM by the cyclin-dependent protein kinase Cdc28 regulates initiation of DNA replication, including blocking reinitiation in G2/M phase [ (PUBMED:17825065) (PUBMED:11572976) (PUBMED:11429609) (PUBMED:16024805) ]. Both ORC1 and ORC5 bind ATP, although only ORC1 has ATPase activity [ (PUBMED:9038340) ]. The binding of ATP by ORC1 is required for ORC binding to DNA and is essential for cell viability [ (PUBMED:16228006) ]. The ATPase activity of ORC1 is involved in formation of the pre-RC [ (PUBMED:11459976) (PUBMED:15610739) (PUBMED:16387651) ]. ATP binding by ORC5 is crucial for the stability of ORC as a whole. Only the ORC1-5 subunits are required for origin binding; ORC6 is essential for maintenance of pre-RCs once formed [ (PUBMED:17053779) ]. Interactions within ORC suggest that ORC2-3-6 may form a core complex [ (PUBMED:17825065) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_16