SMART: Pfam domain AAA

The domain within your query sequence starts at position 209 and ends at position 500; the E-value for the AAA_34 domain shown below is 8.2e-135.

QHPDRVVETSTLSSVPPPDITYTLALPTSDNSTLSALQLEAITYACQQHEVLLPSGQRAG
FLIGDGAGVGKGRTVAGIIVENYLRGRKKALWFSASNDLKYDAERDLRDIEAPGIAVHAL
SKIKYGDNTTSEGVLFATYSALIGESQAGGQHRTRLRQILQWCGEGFDGVIVFDECHKAK
NASSTKMGKAVLDLQSKLPQARVVYASATGASEPRNMIYMSRLGIWGEGTPFRTFEEFLH
AIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVTFRIEEIPLSPAFQQVYNR

AAA_34

PFAM accession number:	PF13872
Interpro abstract (IPR039187):	Strawberry notch proteins carry DExD/H-box groups and helicase C-terminal domains. These proteins promote the expression of diverse targets, potentially through interactions with transcriptional activator or repressor complexes [ (PUBMED:20230814) ]. Strawberry notch was first identified in Drosophila where functions downstream of Notch and regulates gene expression during development [ (PUBMED:9171377) (PUBMED:12419199) ]. This entry represents the AAA domain found in Strawberry notch protein.

PFAM accession number:

PF13872

Interpro abstract (IPR039187):

Strawberry notch proteins carry DExD/H-box groups and helicase C-terminal domains. These proteins promote the expression of diverse targets, potentially through interactions with transcriptional activator or repressor complexes [ (PUBMED:20230814) ]. Strawberry notch was first identified in Drosophila where functions downstream of Notch and regulates gene expression during development [ (PUBMED:9171377) (PUBMED:12419199) ].

This entry represents the AAA domain found in Strawberry notch protein.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_34