The domain within your query sequence starts at position 209 and ends at position 500; the E-value for the AAA_34 domain shown below is 8.2e-135.
QHPDRVVETSTLSSVPPPDITYTLALPTSDNSTLSALQLEAITYACQQHEVLLPSGQRAG FLIGDGAGVGKGRTVAGIIVENYLRGRKKALWFSASNDLKYDAERDLRDIEAPGIAVHAL SKIKYGDNTTSEGVLFATYSALIGESQAGGQHRTRLRQILQWCGEGFDGVIVFDECHKAK NASSTKMGKAVLDLQSKLPQARVVYASATGASEPRNMIYMSRLGIWGEGTPFRTFEEFLH AIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVTFRIEEIPLSPAFQQVYNR
AAA_34 |
![]() |
---|
PFAM accession number: | PF13872 |
---|---|
Interpro abstract (IPR039187): | Strawberry notch proteins carry DExD/H-box groups and helicase C-terminal domains. These proteins promote the expression of diverse targets, potentially through interactions with transcriptional activator or repressor complexes [ (PUBMED:20230814) ]. Strawberry notch was first identified in Drosophila where functions downstream of Notch and regulates gene expression during development [ (PUBMED:9171377) (PUBMED:12419199) ]. This entry represents the AAA domain found in Strawberry notch protein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_34