The domain within your query sequence starts at position 2303 and ends at position 2574; the E-value for the AAA_8 domain shown below is 6.2e-73.
YNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSL FQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVP NLFALDEKQEICEKMRQLDRQRDKTKQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAF RIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEETQEGCIDMCKRFHTSTI NLSTSFHNELQRYNYVTPTSYLELISTFKLLL
AAA_8 |
![]() |
---|
PFAM accession number: | PF12780 |
---|---|
Interpro abstract (IPR024317): | The 380kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380kDa motor unit contains a concatenated chain of six AAA modules, of which four (D1 - D4) correspond to the ATP binding sites with P-loop signatures described previously, and two (D5, D6) are modules in which the P loop has been lost in evolution. This particular entry represents the D4 ATP-binding domain of the motor [ (PUBMED:11250194) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_8