The domain within your query sequence starts at position 190 and ends at position 384; the E-value for the AA_permease domain shown below is 4.1e-25.
GVYLPCLQNIFGVILFLRLTWVVGTAGILQAFAIVLICCCCTMLTAISMSAIATNGVVPA GGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAAIFRSDDALK ESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAP PHFPVCMLGNRTLSS
AA_permease |
---|
PFAM accession number: | PF00324 |
---|---|
Interpro abstract (IPR004841): | Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell. A number of such proteins have been found to be evolutionary related [ (PUBMED:3146645) ], [ (PUBMED:2687114) ], [ (PUBMED:8382989) ]. These proteins seem to contain up to 12 transmembrane segments. The best conserved region in this family is located in the second transmembrane segment. This domain is found in amino acid permeases, as well as in solute carrier family 12A (SLC12A) members. |
GO process: | transmembrane transport (GO:0055085) |
GO component: | membrane (GO:0016020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AA_permease