The domain within your query sequence starts at position 188 and ends at position 304; the E-value for the ABC1 domain shown below is 9.2e-38.
EDFQALPNELFQEFDYEPMAAASLAQVHRAKLHDGTDVAVKVQYIDLRDRFDGDVQTLEL LLRLVELMHPSFGFSWVLQDLKGTLVQELDFENEGRNAERCAQELKHFHYVVIPRVH
ABC1 |
![]() |
---|
PFAM accession number: | PF03109 |
---|---|
Interpro abstract (IPR004147): | This entry represents a domain found in Escherichia coli UbiB, known in Providencia stuartii as Aarf, which is required for ubiquinone (CoQ) biosynthesis [ (PUBMED:10960098) (PUBMED:9422602) (PUBMED:23709220) ]. Some proteins with this domain are described as aarF domain-containing protein kinases (ADCKs). This domain is also found in yeast ABC1 proteins ( P27697 ) required for function of the mitochondrial bc1 complex [ (PUBMED:1648478) ], in which CoQ functions as an essential cofactor. The function of these proteins is not clear. Along with ABC1, UbiB is part of a large family of proteins that contain motifs found in eukaryotic-type protein kinases [ (PUBMED:9799791) ], but is not known if they have kinase activity and how this would relate to their requirement for the monoxygenase step in CoQ synthesis. A role in regulation of this step by phosphorylation has been speculated [ (PUBMED:10960098) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ABC1