The domain within your query sequence starts at position 3 and ends at position 117; the E-value for the ABC_transp_aux domain shown below is 4.6e-13.
KELRSTILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAGPR EKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVR
ABC_transp_aux |
 |
|---|
| PFAM accession number: | PF09822 |
|---|---|
| Interpro abstract (IPR019196): | This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ABC_transp_aux