The domain within your query sequence starts at position 47 and ends at position 107; the E-value for the ACAS_N domain shown below is 8.1e-21.
YRELHRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFTEWMKGATTNICYN V
ACAS_N |
---|
PFAM accession number: | PF16177 |
---|---|
Interpro abstract (IPR032387): | This domain is found at the N terminus of many acetyl-coenzyme A synthetase enzymes. The function of this domain is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACAS_N