The domain within your query sequence starts at position 1 and ends at position 228; the E-value for the ACC_central domain shown below is 8.6e-57.
DNTCVVEFQFMLPTSHPNRMSFASNLNHYGMTHVASVSDVLLDNAFTPPCQRMGGMVSFR TFEDFVRIFDEIMGCFCDSPPQSPTFPESGHTSLYDEDKVPRDEPIHILNVAIKTDGDIE DDRLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVNCEVDQRFHREFPKFFTFRA RDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAA
ACC_central |
![]() |
---|
PFAM accession number: | PF08326 |
---|---|
Interpro abstract (IPR013537): | This region is found in various eukaryotic acetyl-CoA carboxylases, N-terminal to the catalytic domain. Enzymes containing this domain ( EC 6.4.1.2 ) are involved in the synthesis of long-chain fatty acids, as they catalyses the rate limiting step in this process. |
GO process: | fatty acid biosynthetic process (GO:0006633) |
GO function: | acetyl-CoA carboxylase activity (GO:0003989), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACC_central