The domain within your query sequence starts at position 125 and ends at position 244; the E-value for the ACPS domain shown below is 6e-19.
QVGIDIMKTSFPGRGSIPEFFHIMKRKFTKKEWETIRSFNDEWTQLDMFYRHWALKESFI KAIGVGLGFEMQRLEFDVSPLNMDIGQVYKETCLILDGEEEKEWAFEESKIDEHHFVAVA
ACPS |
 |
|---|
| PFAM accession number: | PF01648 |
|---|---|
| Interpro abstract (IPR008278): | The 4'-phosphopantetheinyl transferase superfamily of proteins transfer the 4'-phosphopantetheine (4'-PP) moiety from coenzyme A (CoA) to the invariant serine of pp-binding. This post-translational modification renders holo-ACP capable of acyl group activation via thioesterification of the cysteamine thiol of 4'-PP [ (PUBMED:7559576) ]. This superfamily consists of two subtypes: The ACPS type such as ACPS_ECOLI and the Sfp type such as SFP_BACSU. The structure of the Sfp type is known [ (PUBMED:10581256) ], which shows the active site accommodates a magnesium ion. The most highly conserved regions of the alignment are involved in binding the magnesium ion. |
| GO function: | magnesium ion binding (GO:0000287), holo-[acyl-carrier-protein] synthase activity (GO:0008897) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACPS