The domain within your query sequence starts at position 329 and ends at position 420; the E-value for the ACP_syn_III_C domain shown below is 1.8e-7.
LQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVV TLLNELKRRGRRAYGVVSMCIGTGMGAAAVFE
ACP_syn_III_C |
![]() |
---|
PFAM accession number: | PF08541 |
---|---|
Interpro abstract (IPR013747): | This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III EC 2.3.1.41 the enzyme responsible for initiating the chain of reactions of the fatty acid synthase in plants and bacteria [ (PUBMED:10600651) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACP_syn_III_C