The domain within your query sequence starts at position 1 and ends at position 135; the E-value for the ADP_ribosyl_GH domain shown below is 4.9e-18.
MVKRYVETVETLSEHRPDPSTIEGCSQLKPDNYLLAWHTPFSEKGSGFGAATKAMCIGMR YWKPERLETLIEVSIECGRMTHNHPTGFLGSLCTALFASYALQGKPLVQWGREMLKVLPL AEEYCRKTIRHMAEY
ADP_ribosyl_GH |
---|
PFAM accession number: | PF03747 |
---|---|
Interpro abstract (IPR005502): | This family includes enzymes that perform ADP-ribosylations, such as ADP-ribosylarginine hydrolase EC 3.2.2.19 which cleaves ADP-ribose-L-arginine [ (PUBMED:8349667) ]. The family also includes dinitrogenase reductase activating glycohydrolase [ (PUBMED:2506427) ], and most surprisingly jellyfish crystallins [ (PUBMED:2506427) ], although these proteins appear to have lost the presumed active site residues. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ADP_ribosyl_GH