SMART: Pfam domain AFG1

The domain within your query sequence starts at position 74 and ends at position 432; the E-value for the AFG1_ATPase domain shown below is 4.4e-110.

GPLDHYDFLIKSQELREDEHQRRVVQCLQKLQEDLKGYSIEEGGLFSKLFSRNKPPKGLY
VYGDVGTGKTMVMDMFYAYVETKRKKRVHFHGFMLDVHRRIHHLKQSLPKRKAGFMAKSY
DPIAPIAEEISQETSLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYK
NGLQRANFVPFIAVLKEYCDTLQLDSGVDYRKRELAPAGKLYYLTSEADVEAVVDKLFDE
LAQKQNDLTSPRILKVQGRELRLNKACGSVADCTFEELCERPLGASDYLELSKNFDTVII
RNIPQFSLAKRTQARRFITLIDNFYDFKVRIICSASAPISSLFLHQHQDSESDQSRILM

AFG1_ATPase

PFAM accession number:	PF03969
Interpro abstract (IPR005654):	This P-loop motif-containing family of proteins includes AFG1, LACE1 and ZapE. ATPase family gene 1 (AFG1) is a 377 amino acid yeast protein with an ATPase motif typical of the family [ (PUBMED:1441755) ]. AFG1-like ATPase (also known as lactation elevated 1 or LACE1), the mammalian homologue of AGF1, is a mitochondrial integral membrane protein that is essential for maintenance of fused mitochondrial reticulum and lamellar cristae morphology. It has also been demonstrated that LACE1 mediates degradation of nuclear-encoded complex IV subunits COX4 (cytochrome c oxidase 4), COX5A and COX6A, and is required for normal activity of complexes III and IV of the respiratory chain [ (PUBMED:26759378) ]. ZapE is a cell division protein found in Gram-negative bacteria. The bacterial cell division process relies on the assembly, positioning, and constriction of FtsZ ring (the so-called Z-ring), a ring-like network that marks the future site of the septum of bacterial cell division. ZapE is a Z-ring associated protein required for cell division under low-oxygen conditions. It is an ATPase that appears at the constricting Z-ring late in cell division. It reduces the stability of FtsZ polymers in the presence of ATP in vitro [ (PUBMED:24595368) ].
GO function:	ATP binding (GO:0005524)

PFAM accession number:

PF03969

Interpro abstract (IPR005654):

This P-loop motif-containing family of proteins includes AFG1, LACE1 and ZapE.

ATPase family gene 1 (AFG1) is a 377 amino acid yeast protein with an ATPase motif typical of the family [ (PUBMED:1441755) ].

AFG1-like ATPase (also known as lactation elevated 1 or LACE1), the mammalian homologue of AGF1, is a mitochondrial integral membrane protein that is essential for maintenance of fused mitochondrial reticulum and lamellar cristae morphology. It has also been demonstrated that LACE1 mediates degradation of nuclear-encoded complex IV subunits COX4 (cytochrome c oxidase 4), COX5A and COX6A, and is required for normal activity of complexes III and IV of the respiratory chain [ (PUBMED:26759378) ].

ZapE is a cell division protein found in Gram-negative bacteria. The bacterial cell division process relies on the assembly, positioning, and constriction of FtsZ ring (the so-called Z-ring), a ring-like network that marks the future site of the septum of bacterial cell division. ZapE is a Z-ring associated protein required for cell division under low-oxygen conditions. It is an ATPase that appears at the constricting Z-ring late in cell division. It reduces the stability of FtsZ polymers in the presence of ATP in vitro [ (PUBMED:24595368) ].

GO function:

ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AFG1_ATPase