SMART: Pfam domain AHSA1

The domain within your query sequence starts at position 161 and ends at position 277; the E-value for the AHSA1 domain shown below is 4.3e-22.

DTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGKFQMFDGNISGEYVELVTNRKIIMKWR
CRNWPEEHYATVELNFVPAPGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIKGLLE

AHSA1

PFAM accession number:	PF08327
Interpro abstract (IPR013538):	This family includes eukaryotic, prokaryotic and archaeal proteins that bear similarity to a C-terminal region of human activator of 90kDa heat shock protein ATPase homologue 1 (AHSA1/p38, O95433 ). This protein is known to interact with the middle domain of Hsp90, and stimulate its ATPase activity [ (PUBMED:12604615) ]. It is probably a general up regulator of Hsp90 function, particularly contributing to its efficiency in conditions of increased stress [ (PUBMED:12504007) ]. p38 is also known to interact with the cytoplasmic domain of the VSV G protein, and may thus be involved in protein transport [ (PUBMED:11554768) ]. It has also been reported as being under expressed in Down's syndrome. This region is found repeated in two members of this family ( Q8XY04 and Q6MH87 ).

PFAM accession number:

PF08327

Interpro abstract (IPR013538):

This family includes eukaryotic, prokaryotic and archaeal proteins that bear similarity to a C-terminal region of human activator of 90kDa heat shock protein ATPase homologue 1 (AHSA1/p38, O95433 ). This protein is known to interact with the middle domain of Hsp90, and stimulate its ATPase activity [ (PUBMED:12604615) ]. It is probably a general up regulator of Hsp90 function, particularly contributing to its efficiency in conditions of increased stress [ (PUBMED:12504007) ]. p38 is also known to interact with the cytoplasmic domain of the VSV G protein, and may thus be involved in protein transport [ (PUBMED:11554768) ]. It has also been reported as being under expressed in Down's syndrome. This region is found repeated in two members of this family ( Q8XY04 and Q6MH87 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AHSA1