The domain within your query sequence starts at position 244 and ends at position 339; the E-value for the AIP3 domain shown below is 9.7e-10.
FLQFGEETRRVHITHEVSSLDTLHALIAHMFPQKLTMGMLKSPNTAILIKDEARNVFYEL EDVRDIQDRSIIKIYRKEPLYAAFPGSHLTNGDLRR
AIP3 |
---|
PFAM accession number: | PF03915 |
---|---|
Interpro abstract (IPR022782): | This entry represents the C-terminal domain of actin interacting protein 3 (also known as Bud6 in budding yeasts). Bud6 is an actin- and formin-interacting protein. The N-terminal half of Bud6 is a microtubule binding domain required for its localisation and for its function in cortical capture of astral microtubule ends. The C-terminal half (residues 489-788) directly facilitates actin filament assembly by the formin Bni1 and is required for NPF (nucleation-promoting factor) activity. The domain represented in this entry (residues 365-776) is overlapped with the C-terminal half of Bud6 in this study [ (PUBMED:23161908) ]. This entry also includes proteins from animals. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AIP3