The domain within your query sequence starts at position 485 and ends at position 565; the E-value for the AMP-binding_C domain shown below is 3.3e-22.
EVESALAEHPAVLESAVVSSPDPIRGEVVKAFIVLSPAYASHDPEALTRELQEHVKTVTA PYKYPRKVAFISELPKTVSGK
AMP-binding_C |
![]() |
---|
PFAM accession number: | PF13193 |
---|---|
Interpro abstract (IPR025110): | This is a small domain that is found C-terminal to IPR000873 . It has a central beta sheet core that is flanked by alpha helices. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AMP-binding_C