The domain within your query sequence starts at position 13 and ends at position 104; the E-value for the ANAPC15 domain shown below is 6.5e-43.
STLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEH YDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMN
ANAPC15 |
![]() |
---|
PFAM accession number: | PF15243 |
---|---|
Interpro abstract (IPR026182): | Human ANAPC15 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, it plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C; it is not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating to the responsiveness of the spindle assembly checkpoint. It also required for degradation of CDC20 [ (PUBMED:21926987) ]. |
GO process: | regulation of mitotic cell cycle spindle assembly checkpoint (GO:0090266) |
GO component: | anaphase-promoting complex (GO:0005680) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ANAPC15