The domain within your query sequence starts at position 10 and ends at position 57; the E-value for the ANAPC4_WD40 domain shown below is 9.1e-18.
SFRVVGEKQLPQEIIFLAWSPKRDLIALANTTGEVLLHRLASFHRVWS
ANAPC4_WD40 |
 |
|---|
| PFAM accession number: | PF12894 |
|---|---|
| Interpro abstract (IPR024977): | This entry represents the N-terminal propeller-shaped WD40 domain of the anaphase-promoting complex subunit 4 (Apc4). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ANAPC4_WD40