The domain within your query sequence starts at position 1 and ends at position 79; the E-value for the ANTH domain shown below is 3.5e-19.
XCSHLYHYTVKLMFKLHSCLPADTLQGHRDRFHEQFHSLKNFFRRASDMLYFKRLIQIPR LPEGPPNFLRASALAEHIK
ANTH |
 |
|---|
| PFAM accession number: | PF07651 |
|---|---|
| Interpro abstract (IPR011417): | The AP180 N-terminal homology (ANTH) domain is a membrane binding domain found in endocytotic accessory proteins, such as AP180. AP180 has been implicated in the formation of clathrin-coated pits. The ANTH domain is involved in phosphatidylinositol 4,5-bisphosphate (also known as PIP2) binding. The ANTH domain containing proteins appear to be universal elements in nucleation of clathrin coats [ (PUBMED:12740367) (PUBMED:12742163) ]. |
| GO function: | phospholipid binding (GO:0005543) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ANTH