The domain within your query sequence starts at position 1 and ends at position 162; the E-value for the AP-5_subunit_s1 domain shown below is 8.2e-53.
MVHAFLIHTLRAPNLEDTGLCRVLYSCVFGAEKSPDDPRSHGAERDRLFRKEQILAVARQ VESLCRLQQQAAGCSSTDLQPQFSAEPVSLHEAPHGAFHLAAGDPFQEPRTVLWLGILSL GFALVLDTHENLLLAERTLRLLARLLLDHLRLLTPAVSTGAA
AP-5_subunit_s1 |
---|
PFAM accession number: | PF15001 |
---|---|
Interpro abstract (IPR029392): | This family of proteins are subunits of the adaptor protein complex AP-5, which is involved in endosomal sorting and has links with hereditary spastic paraplegia [ (PUBMED:22022230) (PUBMED:23825025) ]. It is required for efficient homologous recombination DNA double-strand break repair [ (PUBMED:20613862) ]. |
GO process: | double-strand break repair via homologous recombination (GO:0000724), endosomal transport (GO:0016197) |
GO component: | AP-type membrane coat adaptor complex (GO:0030119) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AP-5_subunit_s1